PDB entry 1adx

View 1adx on RCSB PDB site
Description: fifth egf-like domain of thrombomodulin (tmegf5), nmr, 14 structures
Class: blood coagulation
Keywords: blood coagulation, anticoagulant, fibrinogen, nmr, peptide synthesis, protein c, thrombin, disulfide bonds
Deposited on 1997-02-18, released 1997-12-24
The last revision prior to the SCOP 1.75 freeze date was dated 1997-12-24, with a file datestamp of 2007-06-04.
Experiment type: NMR14
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: thrombomodulin
  Species: HOMO SAPIENS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P07204 (0-39)
  Domains in SCOP 1.75: d1adxa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1adxA (A:)
  qmfcnqtacpadcdpntqascecpegyilddgfictdide