PDB entry 1adq

View 1adq on RCSB PDB site
Description: crystal structure of a human igm rheumatoid factor fab in complex with its autoantigen igg fc
Deposited on 1997-02-18, released 1998-09-16
The last revision prior to the SCOP 1.55 freeze date was dated 1998-09-16, with a file datestamp of 1999-04-06.
Experiment type: XRAY
Resolution: 3.15 Å
R-factor: 0.225
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1adqA (A:)
    psvflfppkpkdtlmisrtpevtcvvvdvsqedpqvqfnwyvdgvqvhnaktkpreqqfn
    styrvvsvltvlhqnwldgkeykckvsnkglpssiektiskakgqprepqvytlppsqee
    mtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflysrltvdksrw
    qegnvfscsvmhealhnhytqkslsl
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1adqH (H:)
    evqlvesggglvqpgrslrlscvtsgftfddyamhwvrqspgkglewvsgiswntgtiiy
    adsvkgrfiisrdnaknslylqmnslrvedtalyycaktrsyvvaaeyyfhywgqgilvt
    vssgsasaptlfplvscensnpsstvavgclaqdflpdsitfswkyknnsdisstrgfps
    vlrggkyaatsqvllpskdvmqgtnehvvckvqhpngnkekdvpl
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1adqL (L:)
    yvltqppsvsvapgqtaritcggnnigsksvhwyqqkpgqapvlvvyddsdrppgiperf
    sgsnsgntatltisrveagdeadyycqvwdsssdhavfgggtkltvlgqpkaapsvtlfp
    psseelqankatlvclisdfypgavtvawkadgspvkagvetttpskqsnnkyaassyls
    ltpeqwkshksyscqvthegstvektvaptecs