PDB entry 1aci

View 1aci on RCSB PDB site
Description: l11 ribosomal protein RNA binding domain, nmr, 20 structures
Class: ribosomal protein
Keywords: l11-c76, ribosomal protein
Deposited on 1997-02-07, released 1998-01-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: l11 ribosomal protein
  Species: Geobacillus stearothermophilus [TaxId:1422]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P56210 (1-75)
  Domains in SCOPe 2.08: d1acia_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1aciA (A:)
  mtfitktppaavllkkaagiesgsgepnrnkvatikrdkvreiaelkmpdlnaasieaam
  rmiegtarsmgivved