PDB entry 1acf

View 1acf on RCSB PDB site
Description: acanthamoeba castellanii profilin ib
Deposited on 1994-07-29, released 1994-08-31
The last revision prior to the SCOP 1.69 freeze date was dated 2001-02-15, with a file datestamp of 2001-02-15.
Experiment type: -
Resolution: 2 Å
R-factor: 0.179
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.69: d1acf__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1acf_ (-)
swqtyvdtnlvgtgavtqaailgldgntwatsagfavtpaqgttlagafnnadairaggf
dlagvhyvtlraddrsiygkkgssgvitvktskailvgvynekiqpgtaanvvekladyl
igqgf