PDB entry 1ac6

View 1ac6 on RCSB PDB site
Description: crystal structure of a variable domain mutant of a t-cell receptor alpha chain
Deposited on 1997-02-13, released 1998-02-25
The last revision prior to the SCOP 1.71 freeze date was dated 1998-02-25, with a file datestamp of 1998-02-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.161
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1ac6a_
  • Chain 'B':
    Domains in SCOP 1.71: d1ac6b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ac6A (A:)
    dsvtqtegqvalseedfltihcnysasgypalfwyvqypgegpqflfrasrdkekgssrg
    featynkeatsfhlqkasvqesdsavyycalsggnnkltfgagtkltikp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ac6B (B:)
    dsvtqtegqvalseedfltihcnysasgypalfwyvqypgegpqflfrasrdkekgssrg
    featynkeatsfhlqkasvqesdsavyycalsggnnkltfgagtkltikp