PDB entry 1ac0

View 1ac0 on RCSB PDB site
Description: glucoamylase, granular starch-binding domain complex with cyclodextrin, nmr, minimized average structure
Class: hydrolase
Keywords: hydrolase, starch binding domain
Deposited on 1997-02-10, released 1997-07-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-05-19, with a file datestamp of 2009-05-15.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: glucoamylase
  Species: Aspergillus niger [TaxId:5061]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04064 (0-107)
  Domains in SCOPe 2.07: d1ac0a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ac0A (A:)
  cttptavavtfdltatttygeniylvgsisqlgdwetsdgialsadkytssdplwyvtvt
  lpagesfeykfiriesddsvewesdpnreytvpqacgtstatvtdtwr