PDB entry 1ac0

View 1ac0 on RCSB PDB site
Description: glucoamylase, granular starch-binding domain complex with cyclodextrin, nmr, minimized average structure
Class: hydrolase
Keywords: hydrolase, starch binding domain
Deposited on 1997-02-10, released 1997-07-07
The last revision prior to the SCOP 1.75 freeze date was dated 1997-07-07, with a file datestamp of 2007-06-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucoamylase
    Species: ASPERGILLUS NIGER
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ac0a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ac0A (A:)
    cttptavavtfdltatttygeniylvgsisqlgdwetsdgialsadkytssdplwyvtvt
    lpagesfeykfiriesddsvewesdpnreytvpqacgtstatvtdtwr