PDB entry 1abf

View 1abf on RCSB PDB site
Description: substrate specificity and affinity of a protein modulated by bound water molecules
Class: binding protein
Keywords: binding protein
Deposited on 1992-04-23, released 1993-10-31
The last revision prior to the SCOP 1.73 freeze date was dated 1993-10-31, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 1.9 Å
R-factor: 0.134
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-arabinose-binding protein
    Species: ESCHERICHIA COLI
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1abfa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1abfA (A:)
    enlklgflvkqpeepwfqtewkfadkagkdlgfevikiavpdgektlnaidslaasgakg
    fvictpdpklgsaivakargydmkviavddqfvnakgkpmdtvplvmmaatkigerqgqe
    lykemqkrgwdvkesavmaitaneldtarrrttgsmdalkaagfpekqiyqvptksndip
    gafdaansmlvqhpevkhwlivgmndstvlggvrategqgfkaadiigigingvdavsel
    skaqatgfygsllpspdvhgykssemlynwvakdveppkftevtdvvlitrdnfkeelek
    kglggk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1abfA (A:)
    nlklgflvkqpeepwfqtewkfadkagkdlgfevikiavpdgektlnaidslaasgakgf
    victpdpklgsaivakargydmkviavddqfvnakgkpmdtvplvmmaatkigerqgqel
    ykemqkrgwdvkesavmaitaneldtarrrttgsmdalkaagfpekqiyqvptksndipg
    afdaansmlvqhpevkhwlivgmndstvlggvrategqgfkaadiigigingvdavsels
    kaqatgfygsllpspdvhgykssemlynwvakdveppkftevtdvvlitrdnfkeelekk
    glggk