PDB entry 1ab3

View 1ab3 on RCSB PDB site
Description: ribosomal protein s15 from thermus thermophilus, nmr, 26 structures
Class: ribosomal protein
Keywords: ribosomal protein, RNA-binding protein, rRNA-binding protein
Deposited on 1997-02-03, released 1997-04-01
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ribosomal RNA binding protein s15
  Species: Thermus thermophilus [TaxId:274]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P80378 (0-87)
  Domains in SCOPe 2.01: d1ab3a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ab3A (A:)
  pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
  qrrrllrylqredperyralieklgirg