PDB entry 1ab3

View 1ab3 on RCSB PDB site
Description: ribosomal protein s15 from thermus thermophilus, nmr, 26 structures
Class: ribosomal protein
Keywords: ribosomal protein, RNA-binding protein, rRNA-binding protein
Deposited on 1997-02-03, released 1997-04-01
The last revision prior to the SCOP 1.75 freeze date was dated 1997-04-01, with a file datestamp of 2007-06-04.
Experiment type: NMR26
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribosomal RNA binding protein s15
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ab3a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ab3A (A:)
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyralieklgirg