PDB entry 1ab3

View 1ab3 on RCSB PDB site
Description: ribosomal protein s15 from thermus thermophilus, nmr, 26 structures
Deposited on 1997-02-03, released 1997-04-01
The last revision prior to the SCOP 1.65 freeze date was dated 1997-04-01, with a file datestamp of 1997-04-02.
Experiment type: NMR26
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.65: d1ab3__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ab3_ (-)
    pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
    qrrrllrylqredperyralieklgirg