PDB entry 1ab2

View 1ab2 on RCSB PDB site
Description: three-dimensional solution structure of the src homology 2 domain of c-abl
Deposited on 1993-07-19, released 1994-01-31
The last revision prior to the SCOP 1.59 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.59: d1ab2__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ab2_ (-)
  gsgnslekhswyhgpvsrnaaeyllssgingsflvresesspgqrsislryegrvyhyri
  ntasdgklyvssesrfntlaelvhhhstvadglittlhypapkrgihrd