PDB entry 1aa6

View 1aa6 on RCSB PDB site
Description: reduced form of formate dehydrogenase h from e. coli
Class: oxidoreductase
Keywords: oxidoreductase, selenium, selenocysteine, secys, molybdenum, molybdopterin, mpt, molybdopterin guanine dinucleotide, mgd, iron sulfur cluster, fe4s4, formate, dehydrogenase, anaerobic
Deposited on 1997-01-23, released 1997-08-20
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-01-29, with a file datestamp of 2014-01-24.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.217
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: formate dehydrogenase h
    Species: Escherichia coli [TaxId:562]
    Gene: FDHF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1aa6a1, d1aa6a2
  • Heterogens: SF4, MGD, 4MO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1aa6A (A:)
    mkkvvtvcpycasgckinlvvdngkivraeaaqgktnqgtlclkgyygwdfindtqiltp
    rlktpmirrqrggklepvswdealnyvaerlsaikekygpdaiqttgssrgtgnetnyvm
    qkfaravigtnnvdccarvahgpsvaglhqsvgngamsnaineidntdlvfvfgynpads
    hpivanhvinakrngakiivcdprkietariadmhialkngsniallnamghviieenly
    dkafvasrtegfeeyrkivegytpesveditgvsaseirqaarmyaqaksaailwgmgvt
    qfyqgvetvrsltslamltgnlgkphagvnpvrgqnnvqgacdmgalpdtypgyqyvkdp
    anrekfakawgveslpahtgyriselphraahgevraayimgedplqtdaelsavrkafe
    dlelvivqdifmtktasaadvilpstswgehegvftaadrgfqrffkavepkwdlktdwq
    iiseiatrmgypmhynntqeiwdelrhlcpdfygatyekmgelgfiqwpcrdtsdadqgt
    sylfkekfdtpnglaqfftcdwvapidkltdeypmvlstvrevghyscrsmtgncaalaa
    ladepgyaqintedakrlgiedealvwvhsrkgkiitraqvsdrpnkgaiymtyqwwiga
    cnelvtenlspitktpeykycavrvepiadqraaeqyvideynklktrlreaala
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aa6A (A:)
    mkkvvtvcpycasgckinlvvdngkivraeaaqgktnqgtlclkgyygwdfindtqiltp
    rlktpmirrqrggklepvswdealnyvaerlsaikekygpdaiqttgssrgtgnetnyvm
    qkfaravigtnnvdccarvahgpsvaglhqsvgngamsnaineidntdlvfvfgynpads
    hpivanhvinakrngakiivcdprkietariadmhialkngsniallnamghviieenly
    dkafvasrtegfeeyrkivegytpesveditgvsaseirqaarmyaqaksaailwgmgvt
    qfyqgvetvrsltslamltgnlgkphagvnpvrgqnnvqgacdmgalpdtypgyqyvkdp
    anrekfakawgveslpahtgyriselphraahgevraayimgedplqtdaelsavrkafe
    dlelvivqdifmtktasaadvilpstswgehegvftaadrgfqrffkavepkwdlktdwq
    iiseiatrmgypmhynntqeiwdelrhlcpdfygatyekmgelgfiqwpcrdtsdadqgt
    sylfkekfdtpnglaqfftcdwvapidkltdeypmvlstvrevghyscrsmtgncaalaa
    ladepgyaqintedakrlgiedealvwvhsrkgkiitraqvsdrpnkgaiymtyqwwpey
    kycavrvepiadqraaeqyvideynklktrlreaala