PDB entry 1aa1

View 1aa1 on RCSB PDB site
Description: activated spinach rubisco in complex with the product 3-phosphoglycerate
Class: oxidoreductase
Keywords: oxidoreductase, lyase (carbon-carbon)
Deposited on 1997-01-20, released 1997-07-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.207
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: ribulose bisphosphate carboxylase (large chain)
    Species: Spinacia oleracea [TaxId:3562]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00875
      • modified residue (200)
    Domains in SCOPe 2.05: d1aa1b1, d1aa1b2
  • Chain 'C':
    Compound: ribulose bisphosphate carboxylase (small chain)
    Species: Spinacia oleracea [TaxId:3562]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q43832 (0-122)
      • conflict (1)
      • conflict (5-6)
      • conflict (8)
      • conflict (10)
      • conflict (108)
      • conflict (112)
    Domains in SCOPe 2.05: d1aa1c_
  • Chain 'E':
    Compound: ribulose bisphosphate carboxylase (large chain)
    Species: Spinacia oleracea [TaxId:3562]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00875
      • modified residue (200)
    Domains in SCOPe 2.05: d1aa1e1, d1aa1e2
  • Chain 'F':
    Compound: ribulose bisphosphate carboxylase (small chain)
    Species: Spinacia oleracea [TaxId:3562]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q43832 (0-122)
      • conflict (1)
      • conflict (5-6)
      • conflict (8)
      • conflict (10)
      • conflict (108)
      • conflict (112)
    Domains in SCOPe 2.05: d1aa1f_
  • Chain 'H':
    Compound: ribulose bisphosphate carboxylase (large chain)
    Species: Spinacia oleracea [TaxId:3562]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00875
      • modified residue (200)
    Domains in SCOPe 2.05: d1aa1h1, d1aa1h2
  • Chain 'I':
    Compound: ribulose bisphosphate carboxylase (small chain)
    Species: Spinacia oleracea [TaxId:3562]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q43832 (0-122)
      • conflict (1)
      • conflict (5-6)
      • conflict (8)
      • conflict (10)
      • conflict (108)
      • conflict (112)
    Domains in SCOPe 2.05: d1aa1i_
  • Chain 'L':
    Compound: ribulose bisphosphate carboxylase (large chain)
    Species: Spinacia oleracea [TaxId:3562]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00875
      • modified residue (200)
    Domains in SCOPe 2.05: d1aa1l1, d1aa1l2
  • Chain 'S':
    Compound: ribulose bisphosphate carboxylase (small chain)
    Species: Spinacia oleracea [TaxId:3562]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q43832 (0-122)
      • conflict (1)
      • conflict (5-6)
      • conflict (8)
      • conflict (10)
      • conflict (108)
      • conflict (112)
    Domains in SCOPe 2.05: d1aa1s_
  • Heterogens: MG, 3PG, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1aa1B (B:)
    mspqtetkasvgfkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaae
    sstgtwttvwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsi
    vgnvfgfkalralrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghyl
    natagtcedmmkravfarelgvpivmhdyltggftanttlshycrdnglllhihramhav
    idrqknhgmhfrvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsr
    giyftqswvstpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavan
    rvaleacvqarnegrdlaregntiireatkwspelaaacevwkeikfefpamdtv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aa1B (B:)
    kltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwttvwtdgltnldry
    kgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfkalralrledlri
    pvayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldft
    kddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtcedmmkravfarel
    gvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhgmhfrvlakalrl
    sggdhihsgtvverditlgfvdllrddytekdrsrgiyftqswvstpgvlpvasggihvw
    hmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacvqarnegrdlaregntii
    reatkwspelaaacevwk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aa1C (C:)
    mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
    yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
    agy
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1aa1E (E:)
    mspqtetkasvgfkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaae
    sstgtwttvwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsi
    vgnvfgfkalralrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghyl
    natagtcedmmkravfarelgvpivmhdyltggftanttlshycrdnglllhihramhav
    idrqknhgmhfrvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsr
    giyftqswvstpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavan
    rvaleacvqarnegrdlaregntiireatkwspelaaacevwkeikfefpamdtv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aa1E (E:)
    kltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwttvwtdgltnldry
    kgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfkalralrledlri
    pvayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldft
    kddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtcedmmkravfarel
    gvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhgmhfrvlakalrl
    sggdhihsgtvverditlgfvdllrddytekdrsrgiyftqswvstpgvlpvasggihvw
    hmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacvqarnegrdlaregntii
    reatkwspelaaacevwk
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aa1F (F:)
    mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
    yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
    agy
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1aa1H (H:)
    mspqtetkasvgfkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaae
    sstgtwttvwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsi
    vgnvfgfkalralrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghyl
    natagtcedmmkravfarelgvpivmhdyltggftanttlshycrdnglllhihramhav
    idrqknhgmhfrvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsr
    giyftqswvstpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavan
    rvaleacvqarnegrdlaregntiireatkwspelaaacevwkeikfefpamdtv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aa1H (H:)
    kltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwttvwtdgltnldry
    kgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfkalralrledlri
    pvayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldft
    kddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtcedmmkravfarel
    gvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhgmhfrvlakalrl
    sggdhihsgtvverditlgfvdllrddytekdrsrgiyftqswvstpgvlpvasggihvw
    hmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacvqarnegrdlaregntii
    reatkwspelaaacevwk
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aa1I (I:)
    mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
    yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
    agy
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1aa1L (L:)
    mspqtetkasvgfkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaae
    sstgtwttvwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsi
    vgnvfgfkalralrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghyl
    natagtcedmmkravfarelgvpivmhdyltggftanttlshycrdnglllhihramhav
    idrqknhgmhfrvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsr
    giyftqswvstpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavan
    rvaleacvqarnegrdlaregntiireatkwspelaaacevwkeikfefpamdtv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aa1L (L:)
    kltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwttvwtdgltnldry
    kgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfkalralrledlri
    pvayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldft
    kddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtcedmmkravfarel
    gvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhgmhfrvlakalrl
    sggdhihsgtvverditlgfvdllrddytekdrsrgiyftqswvstpgvlpvasggihvw
    hmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacvqarnegrdlaregntii
    reatkwspelaaacevwk
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aa1S (S:)
    mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
    yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
    agy