PDB entry 1aa1

View 1aa1 on RCSB PDB site
Description: activated spinach rubisco in complex with the product 3-phosphoglycerate
Deposited on 1997-01-20, released 1997-07-07
The last revision prior to the SCOP 1.59 freeze date was dated 1997-07-07, with a file datestamp of 1997-07-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.207
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1aa1B (B:)
    kltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwttvwtdgltnldry
    kgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfkalralrledlri
    pvayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldft
    kddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtcedmmkravfarel
    gvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhgmhfrvlakalrl
    sggdhihsgtvvgklegerditlgfvdllrddytekdrsrgiyftqswvstpgvlpvasg
    gihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacvqarnegrdlare
    gntiireatkwspelaaacevwk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aa1B (B:)
    kltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwttvwtdgltnldry
    kgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfkalralrledlri
    pvayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldft
    kddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtcedmmkravfarel
    gvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhgmhfrvlakalrl
    sggdhihsgtvverditlgfvdllrddytekdrsrgiyftqswvstpgvlpvasggihvw
    hmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacvqarnegrdlaregntii
    reatkwspelaaacevwk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aa1C (C:)
    mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
    yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
    agy
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1aa1E (E:)
    kltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwttvwtdgltnldry
    kgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfkalralrledlri
    pvayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldft
    kddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtcedmmkravfarel
    gvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhgmhfrvlakalrl
    sggdhihsgtvvgklegerditlgfvdllrddytekdrsrgiyftqswvstpgvlpvasg
    gihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacvqarnegrdlare
    gntiireatkwspelaaacevwk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aa1E (E:)
    kltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwttvwtdgltnldry
    kgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfkalralrledlri
    pvayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldft
    kddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtcedmmkravfarel
    gvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhgmhfrvlakalrl
    sggdhihsgtvverditlgfvdllrddytekdrsrgiyftqswvstpgvlpvasggihvw
    hmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacvqarnegrdlaregntii
    reatkwspelaaacevwk
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aa1F (F:)
    mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
    yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
    agy
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1aa1H (H:)
    kltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwttvwtdgltnldry
    kgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfkalralrledlri
    pvayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldft
    kddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtcedmmkravfarel
    gvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhgmhfrvlakalrl
    sggdhihsgtvvgklegerditlgfvdllrddytekdrsrgiyftqswvstpgvlpvasg
    gihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacvqarnegrdlare
    gntiireatkwspelaaacevwk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aa1H (H:)
    kltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwttvwtdgltnldry
    kgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfkalralrledlri
    pvayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldft
    kddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtcedmmkravfarel
    gvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhgmhfrvlakalrl
    sggdhihsgtvverditlgfvdllrddytekdrsrgiyftqswvstpgvlpvasggihvw
    hmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacvqarnegrdlaregntii
    reatkwspelaaacevwk
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aa1I (I:)
    mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
    yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
    agy
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1aa1L (L:)
    kltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwttvwtdgltnldry
    kgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfkalralrledlri
    pvayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldft
    kddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtcedmmkravfarel
    gvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhgmhfrvlakalrl
    sggdhihsgtvvgklegerditlgfvdllrddytekdrsrgiyftqswvstpgvlpvasg
    gihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacvqarnegrdlare
    gntiireatkwspelaaacevwk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aa1L (L:)
    kltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwttvwtdgltnldry
    kgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfkalralrledlri
    pvayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldft
    kddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtcedmmkravfarel
    gvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhgmhfrvlakalrl
    sggdhihsgtvverditlgfvdllrddytekdrsrgiyftqswvstpgvlpvasggihvw
    hmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacvqarnegrdlaregntii
    reatkwspelaaacevwk
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aa1S (S:)
    mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
    yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
    agy