PDB entry 1aa0

View 1aa0 on RCSB PDB site
Description: fibritin deletion mutant e (bacteriophage t4)
Class: attachment protein
Keywords: bacteriophage t4, fibritin, structural protein, bacteriophage assembly, attachment protein
Deposited on 1997-01-18, released 1997-07-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.216
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibritin
    Species: Enterobacteria phage T4 [TaxId:10665]
    Gene: WAC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1aa0a_
  • Heterogens: CL, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aa0A (A:)
    vsglnnavqnlqveignnsagikgqvvalntlvngtnpngstveergltnsikanetnia
    svtqevntakgnisslqgdvqalqeagyipeaprdgqayvrkdgewvllstfl