PDB entry 1a9q

View 1a9q on RCSB PDB site
Description: bovine purine nucleoside phosphorylase complexed with inosine
Class: pentosyltransferase
Keywords: pentosyltransferase, purine nucleoside phosphorylase
Deposited on 1998-04-10, released 1998-07-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.2
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: purine nucleoside phosphorylase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55859 (0-281)
      • conflict (248)
    Domains in SCOPe 2.08: d1a9qa_
  • Heterogens: SO4, HPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a9qA (A:)
    mqngytyedyqdtakwllshteqrpqvavicgsglgglvnkltqaqtfdyseipnfpest
    vpghagrlvfgilngracvmmqgrfhmyegypfwkvtfpvrvfrllgvetlvvtnaaggl
    npnfevgdimlirdhinlpgfsgenplrgpneerfgvrfpamsdaydrdmrqkahstwkq
    mgeqrelqegtyvmlggpnfetvaecrllrnlgadavgmstvpevivarhcglrvfgfsl
    itnkvimdtesqgkanheevleagkqaaqkleqfvsllmasi