PDB entry 1a9n

View 1a9n on RCSB PDB site
Description: crystal structure of the spliceosomal u2b''-u2a' protein complex bound to a fragment of u2 small nuclear RNA
Class: RNA binding protein/RNA
Keywords: complex (nuclear protein/RNA), RNA, snrnp, ribonucleoprotein, RNA binding protein/RNA complex
Deposited on 1998-04-08, released 1998-09-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.38 Å
R-factor: 0.282
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: u2a'
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09661
      • engineered (88)
      • engineered (118)
    Domains in SCOPe 2.05: d1a9na_
  • Chain 'B':
    Compound: spliceosomal u2b''
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1a9nb_
  • Chain 'C':
    Compound: u2a'
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09661
      • engineered (88)
      • engineered (118)
    Domains in SCOPe 2.05: d1a9nc_
  • Chain 'D':
    Compound: spliceosomal u2b''
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1a9nd_
  • Chain 'Q':
    Compound: RNA (5'-r(*cp*cp*up*gp*gp*up*ap*up*up*gp*cp*ap*gp*up*ap*cp*cp*up*cp*cp*ap*gp* gp*u)-3')
    Species: Homo sapiens [TaxId:9606]
  • Chain 'R':
    Compound: RNA (5'-r(*cp*cp*up*gp*gp*up*ap*up*up*gp*cp*ap*gp*up*ap*cp*cp*up*cp*cp*ap*gp* gp*u)-3')
    Species: Homo sapiens [TaxId:9606]

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a9nA (A:)
    mvkltaelieqaaqytnavrdreldlrgykipvienlgatldqfdaidfsdneirkldgf
    pllrrlktllvnnnricrigegldqalpdlteliltnnslvelgdldplaslksltylci
    lrnpvtnkkhyrlyviykvpqvrvldfqkvklkerqeaekmfkgkrgaqlakdiar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a9nA (A:)
    vkltaelieqaaqytnavrdreldlrgykipvienlgatldqfdaidfsdneirkldgfp
    llrrlktllvnnnricrigegldqalpdlteliltnnslvelgdldplaslksltylcil
    rnpvtnkkhyrlyviykvpqvrvldfqkvklkerqeaekmfk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1a9nB (B:)
    mdirpnhtiyinnmndkikkeelkrslyalfsqfghvvdivalktmkmrgqafvifkelg
    sstnalrqlqgfpfygkpmriqyaktdsdiiskmrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a9nB (B:)
    irpnhtiyinnmndkikkeelkrslyalfsqfghvvdivalktmkmrgqafvifkelgss
    tnalrqlqgfpfygkpmriqyaktdsdiiskmrg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1a9nC (C:)
    mvkltaelieqaaqytnavrdreldlrgykipvienlgatldqfdaidfsdneirkldgf
    pllrrlktllvnnnricrigegldqalpdlteliltnnslvelgdldplaslksltylci
    lrnpvtnkkhyrlyviykvpqvrvldfqkvklkerqeaekmfkgkrgaqlakdiar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a9nC (C:)
    vkltaelieqaaqytnavrdreldlrgykipvienlgatldqfdaidfsdneirkldgfp
    llrrlktllvnnnricrigegldqalpdlteliltnnslvelgdldplaslksltylcil
    rnpvtnkkhyrlyviykvpqvrvldfqkvklkerqeaekmfkgkrgaqlakdia
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1a9nD (D:)
    mdirpnhtiyinnmndkikkeelkrslyalfsqfghvvdivalktmkmrgqafvifkelg
    sstnalrqlqgfpfygkpmriqyaktdsdiiskmrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a9nD (D:)
    irpnhtiyinnmndkikkeelkrslyalfsqfghvvdivalktmkmrgqafvifkelgss
    tnalrqlqgfpfygkpmriqyaktdsdiiskmr
    

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    No sequence available.