PDB entry 1a9n

View 1a9n on RCSB PDB site
Description: crystal structure of the spliceosomal u2b''-u2a' protein complex bound to a fragment of u2 small nuclear rna
Deposited on 1998-04-08, released 1998-09-23
The last revision prior to the SCOP 1.61 freeze date was dated 1998-09-23, with a file datestamp of 1998-09-23.
Experiment type: XRAY
Resolution: 2.38 Å
R-factor: 0.282
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1a9na_
  • Chain 'B':
    Domains in SCOP 1.61: d1a9nb_
  • Chain 'C':
    Domains in SCOP 1.61: d1a9nc_
  • Chain 'D':
    Domains in SCOP 1.61: d1a9nd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a9nA (A:)
    vkltaelieqaaqytnavrdreldlrgykipvienlgatldqfdaidfsdneirkldgfp
    llrrlktllvnnnricrigegldqalpdlteliltnnslvelgdldplaslksltylcil
    rnpvtnkkhyrlyviykvpqvrvldfqkvklkerqeaekmfk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a9nB (B:)
    irpnhtiyinnmndkikkeelkrslyalfsqfghvvdivalktmkmrgqafvifkelgss
    tnalrqlqgfpfygkpmriqyaktdsdiiskmrg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a9nC (C:)
    vkltaelieqaaqytnavrdreldlrgykipvienlgatldqfdaidfsdneirkldgfp
    llrrlktllvnnnricrigegldqalpdlteliltnnslvelgdldplaslksltylcil
    rnpvtnkkhyrlyviykvpqvrvldfqkvklkerqeaekmfkgkrgaqlakdia
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a9nD (D:)
    irpnhtiyinnmndkikkeelkrslyalfsqfghvvdivalktmkmrgqafvifkelgss
    tnalrqlqgfpfygkpmriqyaktdsdiiskmr