PDB entry 1a9m

View 1a9m on RCSB PDB site
Description: g48h mutant of hiv-1 protease in complex with a peptidic inhibitor u- 89360e
Deposited on 1998-04-08, released 1998-06-17
The last revision prior to the SCOP 1.71 freeze date was dated 1998-06-17, with a file datestamp of 1998-06-17.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.185
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1a9ma_
  • Chain 'B':
    Domains in SCOP 1.71: d1a9mb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1a9mA (A:)
pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmihgiggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigctlnf

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1a9mB (B:)
pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmihgiggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigctlnf