PDB entry 1a94

View 1a94 on RCSB PDB site
Description: structural basis for specificity of retroviral proteases
Deposited on 1998-04-16, released 1999-01-13
The last revision prior to the SCOP 1.55 freeze date was dated 1999-02-16, with a file datestamp of 1999-02-16.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.182
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1a94a_
  • Chain 'B':
    Domains in SCOP 1.55: d1a94b_
  • Chain 'D':
    Domains in SCOP 1.55: d1a94d_
  • Chain 'E':
    Domains in SCOP 1.55: d1a94e_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a94A (A:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwepkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a94B (B:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwepkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a94D (D:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwepkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a94E (E:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwepkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf