PDB entry 1a91

View 1a91 on RCSB PDB site
Description: subunit c of the f1fo atp synthase of escherichia coli; nmr, 10 structures
Deposited on 1998-04-15, released 1998-07-01
The last revision prior to the SCOP 1.59 freeze date was dated 1998-07-01, with a file datestamp of 1998-07-01.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.59: d1a91__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1a91_ (-)
  menlnmdllymaaavmmglaaigaaigigilggkflegaarqpdlipllrtqffivmglv
  daipmiavglglyvmfava