PDB entry 1a8v

View 1a8v on RCSB PDB site
Description: structure of the rna-binding domain of the rho transcription terminator
Deposited on 1998-03-28, released 1999-05-04
The last revision prior to the SCOP 1.57 freeze date was dated 1999-05-04, with a file datestamp of 1999-05-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.193
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1a8va_
  • Chain 'B':
    Domains in SCOP 1.57: d1a8vb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a8vA (A:)
    ghmnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleil
    qdgfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvne
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a8vA (A:)
    ghmnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleil
    qdgfgflrsaagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvne
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1a8vB (B:)
    ghmnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleil
    qdgfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvne
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a8vB (B:)
    ghmnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleil
    qdgfgflrsadagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvne