PDB entry 1a8p

View 1a8p on RCSB PDB site
Description: ferredoxin reductase from azotobacter vinelandii
Deposited on 1998-03-28, released 1998-06-17
The last revision prior to the SCOP 1.55 freeze date was dated 1998-06-17, with a file datestamp of 1998-06-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.206
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a8p_ (-)
    snlnvervlsvhhwndtlfsfkttrnpslrfengqfvmiglevdgrplmraysiaspnye
    ehleffsikvqngpltsrlqhlkegdelmvsrkptgtlvtsdllpgkhlymlstgtglap
    fmsliqdpevyerfekvvlihgvrqvnelayqqfitehlpqseyfgeavkekliyyptvt
    resfhnqgrltdlmrsgklfediglppinpqddramicgspsmldescevldgfglkisp
    rmgepgdylierafvek