PDB entry 1a8k

View 1a8k on RCSB PDB site
Description: crystallographic analysis of human immunodeficiency virus 1 protease with an analog of the conserved ca-p2 substrate: interactions with frequently occurring glutamic acid residue at p2' position of substrates
Class: complex (aspartyl protease/peptide)
Keywords: human immunodeficiency virus protease, crystal structure, proton-mediated interaction, viral maturation, complex (aspartyl protease/peptide)
Deposited on 1998-03-27, released 1999-01-13
The last revision prior to the SCOP 1.73 freeze date was dated 1999-02-16, with a file datestamp of 2007-06-04.
Experiment type: XRAY+
Resolution: 2 Å
R-factor: 0.174
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hiv protease
  Species: Human immunodeficiency virus 1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03367 (0-98)
    • engineered (6)
    • engineered (32)
    • engineered (62)
  Domains in SCOP 1.73: d1a8ka_
• Chain 'B':
  Compound: hiv protease
  Species: Human immunodeficiency virus 1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03367 (0-98)
    • engineered (6)
    • engineered (32)
    • engineered (62)
  Domains in SCOP 1.73: d1a8kb_
• Chain 'C':
  Compound: peptide
  
• Chain 'D':
  Compound: hiv protease
  Species: Human immunodeficiency virus 1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03367 (0-98)
    • engineered (6)
    • engineered (32)
    • engineered (62)
  Domains in SCOP 1.73: d1a8kd_
• Chain 'E':
  Compound: hiv protease
  Species: Human immunodeficiency virus 1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03367 (0-98)
    • engineered (6)
    • engineered (32)
    • engineered (62)
  Domains in SCOP 1.73: d1a8ke_
• Chain 'F':
  Compound: peptide
  
• Heterogens: NH2, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1a8kA (A:)
  pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
  qiiieicghkaigtvlvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1a8kB (B:)
  pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
  qiiieicghkaigtvlvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1a8kD (D:)
  pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
  qiiieicghkaigtvlvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1a8kE (E:)
  pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
  qiiieicghkaigtvlvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'F':
  No sequence available.