PDB entry 1a8k

View 1a8k on RCSB PDB site
Description: crystallographic analysis of human immunodeficiency virus 1 protease with an analog of the conserved ca-p2 substrate: interactions with frequently occurring glutamic acid residue at p2' position of substrates
Class: hydrolase/hydrolase inhibitor
Keywords: human immunodeficiency virus protease, proton-mediated interaction, viral maturation, hydrolase-hydrolase inhibitor complex
Deposited on 1998-03-27, released 1999-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.174
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367 (0-98)
      • engineered (6)
      • engineered (32)
      • engineered (62)
    Domains in SCOPe 2.07: d1a8ka_
  • Chain 'B':
    Compound: hiv protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367 (0-98)
      • engineered (6)
      • engineered (32)
      • engineered (62)
    Domains in SCOPe 2.07: d1a8kb_
  • Chain 'D':
    Compound: hiv protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367 (0-98)
      • engineered (6)
      • engineered (32)
      • engineered (62)
    Domains in SCOPe 2.07: d1a8kd_
  • Chain 'E':
    Compound: hiv protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367 (0-98)
      • engineered (6)
      • engineered (32)
      • engineered (62)
    Domains in SCOPe 2.07: d1a8ke_
  • Heterogens: 0Q4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a8kA (A:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieicghkaigtvlvgptpvniigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a8kB (B:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieicghkaigtvlvgptpvniigrnlltqigctlnf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a8kD (D:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieicghkaigtvlvgptpvniigrnlltqigctlnf
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a8kE (E:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieicghkaigtvlvgptpvniigrnlltqigctlnf