PDB entry 1a85

View 1a85 on RCSB PDB site
Description: mmp8 with malonic and asparagine based inhibitor
Class: complex (collagenase/inhibitor)
Keywords: collagenase, matrix metalloproteinase, malonic acid, mmp8, complex (collagenase/inhibitor)
Deposited on 1998-04-03, released 1999-04-27
The last revision prior to the SCOP 1.73 freeze date was dated 1999-04-27, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mmp-8
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1a85a_
  • Heterogens: CA, ZN, HMI

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a85A (A:)
    npkwertnltyrirnytpqlseaeveraikdafelwsvaspliftrisqgeadiniafyq
    rdhgdnspfdgpngilahafqpgqgiggdahfdaeetwtntsanynlflvaahefghslg
    lahssdpgalmypnyafretsnyslpqddidgiqaiyg