PDB entry 1a7x

View 1a7x on RCSB PDB site
Description: fkbp12-fk1012 complex
Class: isomerase
Keywords: isomerase, immunophilin
Deposited on 1998-03-18, released 1998-06-17
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fkbp12
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1a7xa_
  • Chain 'B':
    Compound: fkbp12
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1a7xb_
  • Heterogens: FKA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1a7xA (A:)
gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1a7xB (B:)
gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle