PDB entry 1a7q

View 1a7q on RCSB PDB site
Description: fv fragment of mouse monoclonal antibody d1.3 (balb/c, igg1, k) high affinity expressed variant containing ser26l->gly, ile29l->thr, glu81l->asp, thr97l->ser, pro240h->leu, asp258h->ala, lys281h->glu, asn283h->asp and leu312h->val
Deposited on 1998-03-16, released 1998-04-29
The last revision prior to the SCOP 1.55 freeze date was dated 1998-04-29, with a file datestamp of 1998-04-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.178
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Domains in SCOP 1.55: d1a7qh_
  • Chain 'L':
    Domains in SCOP 1.55: d1a7ql_

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a7qH (H:)
    qvqlqesgpglvapsqslsitctvsgfsltgygvnwvrqlpgkglewlgmiwgdgntayn
    salksrlsiskdnsksqvflemdslhtddtaryycarerdyrldywgqgttvtvss
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a7qL (L:)
    divltqspaslsasvgetvtitcraggnthnylawyqqkqgkspqllvyytttlaagvps
    rfsgsgsgtqyslkinslqpddfgsyycqhfwstprsfgggtklei