PDB entry 1a7p

View 1a7p on RCSB PDB site
Description: fv fragment of mouse monoclonal antibody d1.3 (balb/c, igg1, k) engineered mutant pro95l->ser on variant chain l glu81->asp and chain h leu312->val
Deposited on 1998-03-16, released 1998-04-29
The last revision prior to the SCOP 1.55 freeze date was dated 1998-04-29, with a file datestamp of 1998-04-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.174
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Domains in SCOP 1.55: d1a7ph_
  • Chain 'L':
    Domains in SCOP 1.55: d1a7pl_

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a7pH (H:)
    qvqlqesgpglvapsqslsitctvsgfsltgygvnwvrqppgkglewlgmiwgdgntdyn
    salksrlsiskdnsksqvflkmnslhtddtaryycarerdyrldywgqgttvtvss
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a7pL (L:)
    divltqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvyytttladgvps
    rfsgsgsgtqyslkinslqpddfgsyycqhfwstsrtfgggtkleik