PDB entry 1a7o
View 1a7o on RCSB PDB site
Description: fv fragment of mouse monoclonal antibody d1.3 (balb/c, igg1, k) r96l deletion mutant on variant for chain l glu81->asp and chain h leu312->val
Class: immunoglobulin
Keywords: immunoglobulin, variant, deletion mutant
Deposited on
1998-03-16, released
1998-04-29
The last revision prior to the SCOPe 2.04 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.167
AEROSPACI score: 0.45
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'H':
Compound: igg1-kappa d1.3 fv (heavy chain)
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d1a7oh_ - Chain 'L':
Compound: igg1-kappa d1.3 fv (light chain)
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
- Uniprot P01635 (0-105)
- conflict (2)
- conflict (49-51)
- variant (80)
Domains in SCOPe 2.04: d1a7ol_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'H':
Sequence; same for both SEQRES and ATOM records: (download)
>1a7oH (H:)
qvqlqesgpglvapsqslsitctvsgfsltgygvnwvrqppgkglewlgmiwgdgntdyn
salksrlsiskdnsksqvflkmnslhtddtaryycarerdyrldywgqgttvtvss
- Chain 'L':
Sequence; same for both SEQRES and ATOM records: (download)
>1a7oL (L:)
divltqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvyytttladgvps
rfsgsgsgtqyslkinslqpddfgsyycqhfwstptfgggtkleik