PDB entry 1a7o

View 1a7o on RCSB PDB site
Description:
Deposited on 1998-03-16, released 1998-04-29
The last revision prior to the SCOP 1.57 freeze date was dated 1998-04-29, with a file datestamp of 1998-04-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.167
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d1a7oh_
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d1a7ol_

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a7oH (H:)
    qvqlqesgpglvapsqslsitctvsgfsltgygvnwvrqppgkglewlgmiwgdgntdyn
    salksrlsiskdnsksqvflkmnslhtddtaryycarerdyrldywgqgttvtvss
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a7oL (L:)
    divltqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvyytttladgvps
    rfsgsgsgtqyslkinslqpddfgsyycqhfwstptfgggtkleik