PDB entry 1a7n

View 1a7n on RCSB PDB site
Description: fv fragment of mouse monoclonal antibody d1.3 (balb/c, igg1, k) variant for chain l glu81->asp and chain h leu312->val
Class: immunoglobulin
Keywords: immunoglobulin, variant
Deposited on 1998-03-16, released 1998-04-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.155
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'H':
  Compound: igg1-kappa d1.3 fv (heavy chain)
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01820 (0-115)
  Domains in SCOPe 2.08: d1a7nh_
• Chain 'L':
  Compound: igg1-kappa d1.3 fv (light chain)
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01635 (0-106)
    • conflict (2)
    • conflict (49-51)
    • variant (80)
    • conflict (95)
  Domains in SCOPe 2.08: d1a7nl_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'H':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1a7nH (H:)
  qvqlqesgpglvapsqslsitctvsgfsltgygvnwvrqppgkglewlgmiwgdgntdyn
  salksrlsiskdnsksqvflkmnslhtddtaryycarerdyrldywgqgttvtvss
  

  
  
• Chain 'L':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1a7nL (L:)
  divltqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvyytttladgvps
  rfsgsgsgtqyslkinslqpddfgsyycqhfwstprtfgggtkleik