PDB entry 1a75

View 1a75 on RCSB PDB site
Description: whiting parvalbumin
Deposited on 1998-03-19, released 1998-06-17
The last revision prior to the SCOP 1.59 freeze date was dated 1998-06-17, with a file datestamp of 1998-06-17.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.2139
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1a75a_
  • Chain 'B':
    Domains in SCOP 1.59: d1a75b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a75A (A:)
    agiladadcaaavkaceaadsfsykaffakcglsgksaddikkafvfidqdksgfieede
    lklflqvfkagaraltdaetkaflkagdsdgdgaigveewvalvka
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a75B (B:)
    afagiladadcaaavkaceaadsfsykaffakcglsgksaddikkafvfidqdksgfiee
    delklflqvfkagaraltdaetkaflkagdsdgdgaigveewvalvka