PDB entry 1a70

View 1a70 on RCSB PDB site
Description: spinach ferredoxin
Class: iron-sulfur protein
Keywords: iron-sulfur protein, photosynthesis, electron transport
Deposited on 1998-03-19, released 1998-11-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.19
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00221 (0-96)
      • engineered (91)
    Domains in SCOPe 2.07: d1a70a_
  • Heterogens: FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a70A (A:)
    aaykvtlvtptgnvefqcpddvyildaaeeegidlpyscragscsscagklktgslnqdd
    qsfldddqidegwvltcaaypvsdvtiethkkeelta