PDB entry 1a6u

View 1a6u on RCSB PDB site
Description: b1-8 fv fragment
Deposited on 1998-03-03, released 1998-05-27
The last revision prior to the SCOP 1.55 freeze date was dated 1998-05-27, with a file datestamp of 1998-05-27.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.192
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Domains in SCOP 1.55: d1a6uh_
  • Chain 'L':
    Domains in SCOP 1.55: d1a6ul_

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a6uH (H:)
    qvqlqqpgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpnsggtky
    nekfkskatltvdkpsstaymqlssltsedsavyycarydyygssyfdywgqgttvtvss
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a6uL (L:)
    avvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgvp
    arfsgslignkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvl