PDB entry 1a6u
View 1a6u on RCSB PDB site
Description: b1-8 fv fragment
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on
1998-03-03, released
1998-05-27
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.192
AEROSPACI score: 0.42
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'H':
Compound: b1-8 fv (heavy chain)
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1a6uh_ - Chain 'L':
Compound: b1-8 fv (light chain)
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1a6ul_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'H':
Sequence; same for both SEQRES and ATOM records: (download)
>1a6uH (H:)
qvqlqqpgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpnsggtky
nekfkskatltvdkpsstaymqlssltsedsavyycarydyygssyfdywgqgttvtvss
- Chain 'L':
Sequence; same for both SEQRES and ATOM records: (download)
>1a6uL (L:)
avvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgvp
arfsgslignkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvl