PDB entry 1a6t

View 1a6t on RCSB PDB site
Description: fab fragment of mab1-ia monoclonal antibody to human rhinovirus 14 nim-ia site
Class: immunoglobulin
Keywords: immunoglobulin, neutralizes human rhinovirus, igg1
Deposited on 1998-03-03, released 1998-05-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.169
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: igg1 fab1-ia fab (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PIR S25058 (0-209)
      • conflict (1)
      • conflict (4)
      • conflict (10)
      • conflict (19)
      • conflict (24)
      • conflict (30)
      • conflict (38)
      • conflict (40)
      • conflict (44)
      • conflict (48)
      • conflict (51)
      • conflict (63)
      • conflict (69)
      • conflict (75-76)
      • conflict (89)
      • conflict (92)
      • conflict (98)
    Domains in SCOPe 2.06: d1a6ta1, d1a6ta2
  • Chain 'B':
    Compound: igg1 fab1-ia fab (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PIR S38950 (2-216)
      • conflict (9)
      • conflict (12)
      • conflict (27)
      • conflict (29-30)
      • conflict (33)
      • conflict (39-40)
      • conflict (42-43)
      • conflict (49-51)
      • conflict (53-54)
      • conflict (56)
      • conflict (58-59)
      • conflict (61)
      • conflict (68)
      • conflict (73)
      • conflict (81-82)
      • conflict (94)
      • conflict (98-103)
      • conflict (105)
      • conflict (112)
      • conflict (121)
      • conflict (133)
      • conflict (176)
      • conflict (195)
    Domains in SCOPe 2.06: d1a6tb1, d1a6tb2
  • Chain 'C':
    Compound: igg1 fab1-ia fab (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PIR S25058 (0-209)
      • conflict (1)
      • conflict (4)
      • conflict (10)
      • conflict (19)
      • conflict (24)
      • conflict (30)
      • conflict (38)
      • conflict (40)
      • conflict (44)
      • conflict (48)
      • conflict (51)
      • conflict (63)
      • conflict (69)
      • conflict (75-76)
      • conflict (89)
      • conflict (92)
      • conflict (98)
    Domains in SCOPe 2.06: d1a6tc1, d1a6tc2
  • Chain 'D':
    Compound: igg1 fab1-ia fab (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PIR S38950 (2-216)
      • conflict (9)
      • conflict (12)
      • conflict (27)
      • conflict (29-30)
      • conflict (33)
      • conflict (39-40)
      • conflict (42-43)
      • conflict (49-51)
      • conflict (53-54)
      • conflict (56)
      • conflict (58-59)
      • conflict (61)
      • conflict (68)
      • conflict (73)
      • conflict (81-82)
      • conflict (94)
      • conflict (98-103)
      • conflict (105)
      • conflict (112)
      • conflict (121)
      • conflict (133)
      • conflict (176)
      • conflict (195)
    Domains in SCOPe 2.06: d1a6td1, d1a6td2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a6tA (A:)
    qsvlsqspailsaspgekvimtcspsssvsymqwyqqkpgsspkpwiystsnlasgvpgr
    fsgggsgtsfsltisgveaedaatyycqqysshpltfgggtklelkradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a6tB (B:)
    evqlqqsgpdlvkpgasvkisckasgysfstyymhwvkqshgkslewigrvdpdnggtsf
    nqkfkgkailtvdkssstaymelgsltsedsavyycarrddyyfdfwgqgtsltvssakt
    tppsvyplapvcggttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsglyt
    lsssvtvtsstwpsqtitcnvahpasstkvdkkiepr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a6tC (C:)
    qsvlsqspailsaspgekvimtcspsssvsymqwyqqkpgsspkpwiystsnlasgvpgr
    fsgggsgtsfsltisgveaedaatyycqqysshpltfgggtklelkradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a6tD (D:)
    evqlqqsgpdlvkpgasvkisckasgysfstyymhwvkqshgkslewigrvdpdnggtsf
    nqkfkgkailtvdkssstaymelgsltsedsavyycarrddyyfdfwgqgtsltvssakt
    tppsvyplapvcggttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsglyt
    lsssvtvtsstwpsqtitcnvahpasstkvdkkiepr