PDB entry 1a6q

View 1a6q on RCSB PDB site
Description: crystal structure of the protein serine/threonine phosphatase 2c at 2 a resolution
Deposited on 1998-02-27, released 1998-05-27
The last revision prior to the SCOP 1.63 freeze date was dated 1998-05-27, with a file datestamp of 1998-05-27.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.214
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1a6q_ (-)
    gafldkpkmekhnaqgqgnglryglssmqgwrvemedahtaviglpsgleswsffavydg
    hagsqvakyccehlldhitnnqdfkgsagapsvenvkngirtgfleidehmrvmsekkhg
    adrsgstavgvlispqhtyfincgdsrgllcrnrkvhfftqdhkpsnplekeriqnaggs
    vmiqrvngslavsralgdfdykcvhgkgpteqlvspepevhdierseeddqfiilacdgi
    wdvmgneelcdfvrsrlevtddlekvcnevvdtclykgsrdnmsvilicfpnapkvspea
    vkkeaeldkylecrveeiikkqgegvpdlvhvmrtlasenipslppggelaskrnvieav
    ynrlnpy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a6q_ (-)
    gafldkpkmekhnaqgqgnglryglssmqgwrvemedahtaviglpsgleswsffavydg
    hagsqvakyccehlldhitnnqdfkgsagapsvenvkngirtgfleidehmrvmsekkhg
    adrsgstavgvlispqhtyfincgdsrgllcrnrkvhfftqdhkpsnplekeriqnaggs
    vmiqrvngslavsralgdfdykcvhgkgpteqlvspepevhdierseeddqfiilacdgi
    wdvmgneelcdfvrsrlevtddlekvcnevvdtclykgsrdnmsvilicfpnapkvspea
    vkkeaeldkylecrveeiikgvpdlvhvmrtlasenipslppggelaskrnvieavynrl
    npy