PDB entry 1a6q

View 1a6q on RCSB PDB site
Description: crystal structure of the protein serine/threonine phosphatase 2c at 2 a resolution
Class: hydrolase
Keywords: catalytic mechanism, metalloenzyme, protein phosphatase 2c, signal transductuin, hydrolase
Deposited on 1998-02-27, released 1998-05-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-27, with a file datestamp of 2011-07-22.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.214
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphatase 2c
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a6qa1, d1a6qa2
  • Heterogens: MN, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a6qA (A:)
    mgafldkpkmekhnaqgqgnglryglssmqgwrvemedahtaviglpsgleswsffavyd
    ghagsqvakyccehlldhitnnqdfkgsagapsvenvkngirtgfleidehmrvmsekkh
    gadrsgstavgvlispqhtyfincgdsrgllcrnrkvhfftqdhkpsnplekeriqnagg
    svmiqrvngslavsralgdfdykcvhgkgpteqlvspepevhdierseeddqfiilacdg
    iwdvmgneelcdfvrsrlevtddlekvcnevvdtclykgsrdnmsvilicfpnapkvspe
    avkkeaeldkylecrveeiikkqgegvpdlvhvmrtlasenipslppggelaskrnviea
    vynrlnpyknddtdststddmw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a6qA (A:)
    gafldkpkmekhnaqgqgnglryglssmqgwrvemedahtaviglpsgleswsffavydg
    hagsqvakyccehlldhitnnqdfkgsagapsvenvkngirtgfleidehmrvmsekkhg
    adrsgstavgvlispqhtyfincgdsrgllcrnrkvhfftqdhkpsnplekeriqnaggs
    vmiqrvngslavsralgdfdykcvhgkgpteqlvspepevhdierseeddqfiilacdgi
    wdvmgneelcdfvrsrlevtddlekvcnevvdtclykgsrdnmsvilicfpnapkvspea
    vkkeaeldkylecrveeiikgvpdlvhvmrtlasenipslppggelaskrnvieavynrl
    npy