PDB entry 1a6p

View 1a6p on RCSB PDB site
Description: engineering of a misfolded form of cd2
Class: cell adhesion
Keywords: domain swapping, hinge loop, oligomer evolution, t lymphocyte adhesion glycoprotein, cell adhesion
Deposited on 1998-02-26, released 1998-06-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: 0.219
AEROSPACI score: -1.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: T-cell surface antigen cd2
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a6pa_
  • Chain 'B':
    Compound: T-cell surface antigen cd2
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a6pb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a6pA (A:)
    gtvwgalghginlnipnfqmtddidevrwergstlvaefkrkpflksgafeilangdlki
    knltrddsgtynvtvystngtrildkaldlrile
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a6pB (B:)
    gtvwgalghginlnipnfqmtddidevrwergstlvaefkrkpflksgafeilangdlki
    knltrddsgtynvtvystngtrildkaldlrile