PDB entry 1a6p
View 1a6p on RCSB PDB site
Description: engineering of a misfolded form of cd2
Class: cell adhesion
Keywords: domain swapping, hinge loop, oligomer evolution, t lymphocyte adhesion glycoprotein, cell adhesion
Deposited on
1998-02-26, released
1998-06-17
The last revision prior to the SCOPe 2.02 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: 0.219
AEROSPACI score: -1.59
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: T-cell surface antigen cd2
Species: Rattus norvegicus [TaxId:10116]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d1a6pa_ - Chain 'B':
Compound: T-cell surface antigen cd2
Species: Rattus norvegicus [TaxId:10116]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d1a6pb_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1a6pA (A:)
gtvwgalghginlnipnfqmtddidevrwergstlvaefkrkpflksgafeilangdlki
knltrddsgtynvtvystngtrildkaldlrile
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1a6pB (B:)
gtvwgalghginlnipnfqmtddidevrwergstlvaefkrkpflksgafeilangdlki
knltrddsgtynvtvystngtrildkaldlrile