PDB entry 1a6f

View 1a6f on RCSB PDB site
Description: rnase p protein from bacillus subtilis
Deposited on 1998-02-24, released 1999-03-23
The last revision prior to the SCOP 1.69 freeze date was dated 1999-03-23, with a file datestamp of 1999-03-23.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.205
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.69: d1a6f__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1a6f_ (-)
    mahlkkrnrlkknedfqkvfkhgtsvanrqfvlytldqpendelrvglsvskkignavmr
    nrikrlirqafleekerlkekdyiiiarkpasqltyeetkkslqhlfrksslykksssk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a6f_ (-)
    ahlkkrnrlkknedfqkvfkhgtsvanrqfvlytldqpendelrvglsvskkignavmrn
    rikrlirqafleekerlkekdyiiiarkpasqltyeetkkslqhlfrksslyk