PDB entry 1a5j

View 1a5j on RCSB PDB site
Description: chicken b-myb DNA binding domain, repeat 2 and repeat3, nmr, 32 structures
Class: DNA-binding protein
Keywords: DNA-binding protein, protooncogene product
Deposited on 1998-02-16, released 1998-07-01
The last revision prior to the SCOP 1.73 freeze date was dated 1998-07-01, with a file datestamp of 2007-06-04.
Experiment type: NMR32
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: b-myb
  Species: GALLUS GALLUS
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q03237 (2-109)
  Domains in SCOP 1.73: d1a5ja1, d1a5ja2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1a5jA (A:)
  gipdlvkgpwtkeedqkvielvkkygtkqwtliakhlkgrlgkqcrerwhnhlnpevkks
  swteeedriifeahkvlgnrwaeiakllpgrtdnavknhwnstikrkvdt