PDB entry 1a52

View 1a52 on RCSB PDB site
Description: estrogen receptor alpha ligand-binding domain complexed to estradiol
Class: receptor
Keywords: receptor, estrogen, ligand, transcription regulation
Deposited on 1998-02-19, released 1998-09-16
The last revision prior to the SCOP 1.73 freeze date was dated 1998-09-16, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.223
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor
    Species: HOMO SAPIENS
    Gene: ESR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372
      • conflict (205)
    Domains in SCOP 1.73: d1a52a_
  • Chain 'B':
    Compound: Estrogen receptor
    Species: HOMO SAPIENS
    Gene: ESR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372
      • conflict (205)
    Domains in SCOP 1.73: d1a52b_
  • Heterogens: EST, AU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a52A (A:)
    mikrskknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvh
    minwakrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgk
    cvegmveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhih
    rvldkitdtlihlmakagltlqqqherlaqlllilshirhmsnkgmehlysmkcknvvpl
    ydlllemldahrlhapts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a52A (A:)
    lalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvp
    gfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveif
    dmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdt
    lihlmakagltlqqqherlaqlllilshirhmsnkgmehlysmkcknvvplydllleml
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1a52B (B:)
    mikrskknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvh
    minwakrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgk
    cvegmveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhih
    rvldkitdtlihlmakagltlqqqherlaqlllilshirhmsnkgmehlysmkcknvvpl
    ydlllemldahrlhapts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a52B (B:)
    slalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrv
    pgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmvei
    fdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitd
    tlihlmakagltlqqqherlaqlllilshirhmsnkgmehlysmkcknvvplydllleml