PDB entry 1a4j

View 1a4j on RCSB PDB site
Description:
Deposited on 1998-01-30, released 1998-05-13
The last revision prior to the SCOP 1.65 freeze date was dated 1998-05-13, with a file datestamp of 1998-05-13.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.229
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1a4ja1, d1a4ja2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1a4jb1, d1a4jb2
  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1a4jh1, d1a4jh2
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1a4jl1, d1a4jl2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a4jA (A:)
    elvmtqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpptfgggtkleikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1a4jB (B:)
    qvqllesgpelkkpgetvkisckasgytftnygmnwvkqapgkglkwmgwintytgepty
    addfkgrfafsletsastaylqinnlknedtatyfcvqaerlrrtfdywgagttvtvssa
    stkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg
    lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a4jB (B:)
    qvqllesgpelkkpgetvkisckasgytftnygmnwvkqapgkglkwmgwintytgepty
    addfkgrfafsletsastaylqinnlknedtatyfcvqaerlrrtfdywgagttvtvssa
    stkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg
    lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkv
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1a4jH (H:)
    qvqllesgpelkkpgetvkisckasgytftnygmnwvkqapgkglkwmgwintytgepty
    addfkgrfafsletsastaylqinnlknedtatyfcvqaerlrrtfdywgagttvtvssa
    stkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg
    lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a4jH (H:)
    qvqllesgpelkkpgetvkisckasgytftnygmnwvkqapgkglkwmgwintytgepty
    addfkgrfafsletsastaylqinnlknedtatyfcvqaerlrrtfdywgagttvtvssa
    stkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg
    lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkv
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a4jL (L:)
    elvmtqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpptfgggtkleikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrg