PDB entry 1a43

View 1a43 on RCSB PDB site
Description: structure of the hiv-1 capsid protein dimerization domain at 2.6a resolution
Deposited on 1998-02-10, released 1999-02-09
The last revision prior to the SCOP 1.71 freeze date was dated 1999-02-09, with a file datestamp of 1999-02-09.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.223
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d1a43__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download) 
    >1a43_ (-)
msptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilka
lgpgatleemmtacqgvggpghkarvl

    Sequence, based on observed residues (ATOM records): (download) 
    >1a43_ (-)
tsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgp
gatleemmtacq