PDB entry 1a43

View 1a43 on RCSB PDB site
Description: structure of the hiv-1 capsid protein dimerization domain at 2.6a resolution
Deposited on 1998-02-10, released 1999-02-09
The last revision prior to the SCOP 1.55 freeze date was dated 1999-02-09, with a file datestamp of 1999-02-09.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.223
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1a43__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1a43_ (-)
  tsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgp
  gatleemmtacq