PDB entry 1a3r

View 1a3r on RCSB PDB site
Description: fab fragment (antibody 8f5) complexed with peptide from human rhinovirus (serotype 2) viral capsid protein vp2 (residues 156-170)
Class: Viral protein/Immune system
Keywords: IMMUNOGLOBULIN, ANTIBODY, RHINOVIRUS, NEUTRALIZATION, CONTINUOUS EPITOPE, COMPLEX (IMMUNOGLOBULIN/VIRAL PEPTIDE), Viral protein/Immune system COMPLEX
Deposited on 1998-01-23, released 1998-04-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.171
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: igg2a 8f5 fab (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1A3R (Start-217)
    Domains in SCOPe 2.06: d1a3rh1, d1a3rh2
  • Chain 'L':
    Compound: igg2a 8f5 fab (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1A3R (0-219)
    Domains in SCOPe 2.06: d1a3rl1, d1a3rl2
  • Chain 'P':
    Compound: human rhinovirus capsid protein vp2
    Species: Human rhinovirus 2 [TaxId:12130]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1a3rH (H:)
    evqlqqsgaelvrpgasvklscttsgfnikdiyihwvkqrpeqglewigrldpangytky
    dpkfqgkatitvdtssntaylhlssltsedtavyycdgyysyydmdywgpgtsvtvssak
    ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
    tlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a3rH (H:)
    vqlqqsgaelvrpgasvklscttsgfnikdiyihwvkqrpeqglewigrldpangytkyd
    pkfqgkatitvdtssntaylhlssltsedtavyycdgyysyydmdywgpgtsvtvssakt
    tapsvyplapvcssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlsssv
    tvtsstwpsqsitcnvahpasstkvdkkiepr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a3rL (L:)
    divmtqspssltvttgekvtmtckssqsllnsrtqknyltwyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftlsisgvqaedlavyycqnnynypltfgagtklelkradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'P':
    No sequence available.