PDB entry 1a3p

View 1a3p on RCSB PDB site
Description: role of the 6-20 disulfide bridge in the structure and activity of epidermal growth factor, nmr, 20 structures
Deposited on 1998-01-22, released 1998-07-29
The last revision prior to the SCOP 1.55 freeze date was dated 1998-07-29, with a file datestamp of 1998-07-29.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1a3p__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1a3p_ (-)
    pgxpssydgyclnggvxmhiesldsytcncvigysgdrcqtrdlr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a3p_ (-)
    pgpssydgyclnggvmhiesldsytcncvigysgdrcqtrdlr